PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0900s0060.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family NAC
Protein Properties Length: 331aa    MW: 37288.4 Da    PI: 5.8371
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0900s0060.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM173.56.3e-5461331128
                     NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWka 85 
                             lppGfrFhPtdeelv +yL++k++g ++el evi+ +d+yk++Pw+Lp k  + +++ ew+fF++rd+ky++g+r+nratk+gyWka
  SapurV1A.0900s0060.2.p   6 LPPGFRFHPTDEELVGYYLQRKAQGLEIEL-EVIPVIDLYKFDPWELPeKsFLPKRDMEWFFFCPRDRKYPNGSRTNRATKAGYWKA 91 
                             79****************************.99**************95344555788***************************** PP

                     NAM  86 tgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                             tgkd+++ + +++l+g +ktLvfy+grap+g +tdWvmheyrl
  SapurV1A.0900s0060.2.p  92 TGKDRKIAC-QSALTGYRKTLVFYQGRAPSGDRTDWVMHEYRL 133
                             *********.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.54E-624156IPR003441NAC domain
PROSITE profilePS5100558.0366156IPR003441NAC domain
PfamPF023653.5E-297133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008283Biological Processcell proliferation
GO:0071365Biological Processcellular response to auxin stimulus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 331 aa     Download sequence    Send to blast
MGGASLPPGF RFHPTDEELV GYYLQRKAQG LEIELEVIPV IDLYKFDPWE LPEKSFLPKR  60
DMEWFFFCPR DRKYPNGSRT NRATKAGYWK ATGKDRKIAC QSALTGYRKT LVFYQGRAPS  120
GDRTDWVMHE YRLCDDISQG SPNFKGAFAL CRVVKKNEQG LKISNSPGEP KAKQVESSSS  180
TVISNEPSNM AFAMSSQASH LYTNESRYSS PIASPYQVAP MSEFEPAASM ESYPSSHWIS  240
PDLILDSSKD YSQVHETAAQ YLPQYEYPGS MDAWQPDRHR EFSPGSSYSN FTGEIEPTDD  300
LNHIGFLSPY SGHGNFLGFA GNDDMHYQGY *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-54516216171NO APICAL MERISTEM PROTEIN
1ut4_B1e-54516216171NO APICAL MERISTEM PROTEIN
1ut7_A1e-54516216171NO APICAL MERISTEM PROTEIN
1ut7_B1e-54516216171NO APICAL MERISTEM PROTEIN
4dul_A1e-54516216171NAC domain-containing protein 19
4dul_B1e-54516216171NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00439DAPTransfer from AT4G17980Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCU2241058e-90CU224105.1 Populus EST from leave.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006368425.10.0hypothetical protein POPTR_0001s02710g
TrEMBLU5GS830.0U5GS83_POPTR; Uncharacterized protein
STRINGPOPTR_0001s02710.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17980.11e-110NAC domain containing protein 71